SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0BWS8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0BWS8
Domain Number 1 Region: 137-279
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.86e-43
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.00022
Further Details:      
 
Domain Number 2 Region: 4-129
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 9.1e-40
Family UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0BWS8
Sequence length 291
Comment (tr|B0BWS8|B0BWS8_RICRO) UDP-3-O-[R-3-hydroxymyristoyl]-N-acetylglucosamine deacetylase {ECO:0000256|HAMAP-Rule:MF_00388} KW=Complete proteome OX=452659 OS=Rickettsia rickettsii (strain Iowa). GN=RrIowa_0409 OC=Rickettsiaceae; Rickettsieae; Rickettsia; spotted fever group.
Sequence
MPKMQQSTLLKPVSCYGIGVHSGKRTQLTIEPAKENTGIIFIRTDISSENNYIEASYFNV
SDTLLSTTISNDHKVQISTIEHLMAALWGCSIDNAIIKIDGPEVPIMDGSSKPFVFMIEC
AGKKLQNAPKKYLKILKDIKVVHKDCELYCTPSDHMTVDLTIDFSSKAIGRQNLSFRDQE
SFTKNIADARTFGFIRDVDYLKSKGLAQGASFENAIGIDEQDKILNPNGLRYEDEFVRHK
LLDLFGDLYTNGTSIVSAIKGYKTSHALNNELLHRIFSDTTSYKFVTSSEL
Download sequence
Identical sequences B0BWS8 C4K132
452659.RrIowa_0409 562019.RPR_02180 gi|165932921|ref|YP_001649710.1| gi|238650479|ref|YP_002916331.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]