SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0BZ74 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0BZ74
Domain Number 1 Region: 15-347
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-55
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 402-513
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 5.36e-31
Family Pentapeptide repeats 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0BZ74
Sequence length 532
Comment (tr|B0BZ74|B0BZ74_ACAM1) Serine/threonine-protein kinase B {ECO:0000256|PIRNR:PIRNR000647} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_4542 OC=Acaryochloris.
Sequence
MSYCLNPACTNPSNAPRQMVCQACGSNLVLRDRYRSTRILGRGGFATTFLAEDEGLPGKP
TCVIKQLRPVVTAPHILEMSRELFQREAETLGKIGNHPQLPRLLDYFELGQEFFLVQEYV
KGATLQQEVRRSGPFDESMVYNVLEEVLPLMEHLHSVEVIHRDLKPANIIRREIDDKLVV
IDFGAVKDQVSQTAIANPDENSTLTSFAVGTPGFAPPEQMAMRPVYASDVYSLGVTCIYL
LTGKSPKDLSYNPVSGELSWREHVRVGPELQEILGKMLEISLRDRYRSAKEVLQALAKNA
SGPSSGISASQPPRRSSSSSRSYSPTRPRSNSPSSRAASGIRRYNSRAQSPLSGALSKVS
GQLSTPRSSYTGLDSSSSLSSRGPKKARLTPNAVQHAYGRGQRDFSGQDLRNLNLRKFQL
PSANFHEGKFQNTDLRDAILINANFGRANFTGANLRNANLMQAYMSHADLANADLRGANL
SDAYLSHANLRGANLCGADLSGAKLSESQLSFAQTNWLTVYPNGKRGKKGRC
Download sequence
Identical sequences B0BZ74
329726.AM1_4542 gi|158337660|ref|YP_001518836.1| WP_012164828.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]