SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0C1L0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0C1L0
Domain Number 1 Region: 4-362
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.24e-62
Family AAT-like 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0C1L0
Sequence length 367
Comment (tr|B0C1L0|B0C1L0_ACAM1) L-threonine-O-3-phosphate decarboxylase, putative {ECO:0000313|EMBL:ABW30844.1} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_5905 OC=Acaryochloris.
Sequence
MSRPLHGGNLRWAADIAGCSPNCILDFSASINPLGPPESAISAIQTHLDTLTAYPDPSYQ
SICQVLSEVHQLPVDWFLPGNGSAELLTWACRDLAQLAWTGVLKPAFADYQRALKAFQAQ
IRPLPLNLRQIQHQSSSELIEQALQIARQSADSAQAGLLLNNPHNPTGGLISIHQIEPFL
EQFPLVVVDEAFMDFLPVDADYSLISKVQDFPNLVILRSLTKFYSLPGLRLGYAIGHPDQ
LRPWQQCRDPWSVNSLAVMAGIAVLGDRAFQNKTLSWLPPVRTELMQGLVALGAYPLEGA
ANFLLVQTKVSVPLLQELLLKHHRILIRDCLSFPELGDQYFRIAVRTQADNQRLLTALAD
CLPRLSV
Download sequence
Identical sequences B0C1L0
gi|158338986|ref|YP_001520163.1| WP_012166050.1.67183 329726.AM1_5905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]