SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0C205 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0C205
Domain Number 1 Region: 4-391
Classification Level Classification E-value
Superfamily PLP-dependent transferases 9.97e-104
Family GABA-aminotransferase-like 0.00000333
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0C205
Sequence length 394
Comment (sp|B0C205|BIOF_ACAM1) 8-amino-7-ketopelargonate synthase KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=bioF; OC=Acaryochloris.
Sequence
MAAYDWIESALATVHKANWYRSVKTMSSPGPTAVLNGQTVINFASNDYLGLAGDSRLAEA
AIAAINTYGTGSTGSRLLSGHRMIHEQLERAIATWKQTETAIVYSSGYLANIGTITALVN
KRDLILADAYNHASLKNGARLSGATIHEFGHANVTELQTLLETHRSHHRRCLLVTDSVFS
MDGDLCPLPELIALAEQYDCMLLIDEAHGTGVLGKTGAGCVEHFGCRDAELIQMGTLSKA
LGSLGGYVAGSASLIDYLRNRSSSWIYTTGLSPADTAAALAAVEIIREGSELRSQLWQRV
TQLKQALTTHLAPEDEHQTMQLLPSESPILCVQMPTPAAVLTASQQLLDQGIFAPAIRPP
TVPTSRIRISIMATHQAVQIDQLIVALSEVAQGS
Download sequence
Identical sequences B0C205
329726.AM1_2296 WP_012162780.1.67183 gi|158335448|ref|YP_001516620.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]