SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0C2K7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0C2K7
Domain Number 1 Region: 5-293
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 9.92e-73
Family AstE/AspA-like 0.00000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0C2K7
Sequence length 295
Comment (sp|B0C2K7|ASPA_ACAM1) Probable aspartoacylase {ECO:0000255|HAMAP-Rule:MF_00704} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_5959; OC=Acaryochloris.
Sequence
MNTNHIRQVVIVGGTHGNERIGLYLVKKFNQDSSLLFRPNLTTNCLIGNPQACKENQRYI
ETDLNRCFIKADLDNHLLGRHEEKQAKVLHEQLGPKGNSENFLLDLHSTTANMGLTLILV
NDHPFNLHLAAYLTHHNPQVRVYRWTQENQENAFVSSLCQLGFAIEVGPIPQGILLASLF
KETETLIHQTLDYLEQVNRGASPPLPKTLTLFQHLEVVDYPKTSNGELAGMIHPQLQGRD
YQPLNPGDPIFLTFEDQTLFYEGCSTVWPIFINEAAYYEKGIAMCLTHKQDISLK
Download sequence
Identical sequences B0C2K7
329726.AM1_5959 gi|158339037|ref|YP_001520214.1| WP_012166097.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]