SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0C5T8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0C5T8
Domain Number 1 Region: 7-274
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.86e-50
Family Bacterial dinuclear zinc exopeptidases 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0C5T8
Sequence length 284
Comment (tr|B0C5T8|B0C5T8_ACAM1) Peptidase, M28 family {ECO:0000313|EMBL:ABW29950.1} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_4982 OC=Acaryochloris.
Sequence
MGSPLQKRLLQHLSHLARERDPYLATAGHFFVKEYIYQELSQWGTVRRHSFRTLKKVAKS
IHENLILSLPGRQSLPPILIGAHFDGVPGSPGADDNATGVAVLLELAQHFHHHPARHPIH
IIGFDLEEYGRLGSQAYAQELRQTNTRITTMISLEMLGYIDARKHTQRYPPGLKYLYPST
GNFIALLGNLRSIPTMFKMSTHFKRNGAPCEWLPVPLRGTPIPDTRRSDHASFWDYGYSA
VMVTDTADSRNPHYHKPSDTIATLNLEFLESIYIGLVQAIQNGM
Download sequence
Identical sequences B0C5T8
gi|158338092|ref|YP_001519268.1| 329726.AM1_4982 WP_012165223.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]