SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0C6H4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0C6H4
Domain Number 1 Region: 1-64
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.0000000000000051
Family 7-Fe ferredoxin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0C6H4
Sequence length 75
Comment (tr|B0C6H4|B0C6H4_ACAM1) 4Fe-4S ferredoxin, iron-sulfur binding domain {ECO:0000313|EMBL:ABW26395.1} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_1363 OC=Acaryochloris.
Sequence
MAHTIVTDVCEGIADCVDACPVACIHEGPGKNVIGTDWYWIDFSTCIDCGICQQVCPVDG
AILAEERSDLQKTPS
Download sequence
Identical sequences B0C6H4
gi|158334537|ref|YP_001515709.1| WP_010481866.1.53659 WP_010481866.1.67183 329726.AM1_1363

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]