SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0C811 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0C811
Domain Number 1 Region: 3-76
Classification Level Classification E-value
Superfamily L28p-like 2.75e-25
Family Ribosomal protein L28 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0C811
Sequence length 78
Comment (sp|B0C811|RL28_ACAM1) 50S ribosomal protein L28 {ECO:0000255|HAMAP-Rule:MF_00373} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_2695; OC=Acaryochloris.
Sequence
MGKKCQLTGKKANNAFAVSHSHRRTHKLQEANLQWKRVWWPQEKRWVKLRLSTKAIKTLE
KKGLAAFAREAGINLNQV
Download sequence
Identical sequences B0C811
WP_010473270.1.53659 WP_010473270.1.67183 gi|158335837|ref|YP_001517011.1| 329726.AM1_2695

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]