SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0C818 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0C818
Domain Number 1 Region: 12-249,369-408
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.41e-33
Family FAD-linked reductases, N-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0C818
Sequence length 569
Comment (tr|B0C818|B0C818_ACAM1) Glycerol-3-phosphate dehydrogenase domain protein {ECO:0000313|EMBL:ABW27702.1} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_2702 OC=Acaryochloris.
Sequence
MKRNLEELSNTKFDVLVIGGGIYGACVAYEATLRGLSVALVEKQDFCGATSANSLKTIHG
GLRYLQHADFKRMRESIYERRTLMKIAPHLIHPLPVLVPTYGHGLKGIEAMTVALKINDL
VSCDRNLGLPDPQKHIPTGQTLSPTECLNTLPGISADGLTGGAIFHDAQVYNSERLVLAY
LQSATQLGLQAANYLEVTGFLQTGSTICGVQVTDALTADTFDIQAKAIINTSGPWINQVL
GLLKPPLTNHQPFALAMNLVTRSLFDHDYAIGLYSKADYTDKDAILKRKNRLLFIAPWQG
CSLIGTTYSHYPGTPDQLSVPQNEVQHLLDDINNAYPPANLTPQDVYWVHQGLLPSSHSQ
ETTNVQLTKHYHVQDYQKEGFNGLISVTGVKYTTARHVAIHAVDTAVAMLQKPVTLSQSA
QHPLQGGAIENLSEFLQHGQKQLDHITDCQSVQHFLYNYGTTYSSVLKQVQHGQRATSQL
DLLQAQVTYAIEEEMAHTLSDVIFRRTGIGGAQMPTPAELQTCADVMSKTLLWSQSRVEQ
EISDVTSRWSWSIPKPPSVGEQTATIQGI
Download sequence
Identical sequences B0C818
WP_012163151.1.67183 329726.AM1_2702 gi|158335844|ref|YP_001517018.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]