SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0C8J3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0C8J3
Domain Number 1 Region: 4-192,241-380
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.33e-73
Family TK-like PP module 0.004
Further Details:      
 
Domain Number 2 Region: 315-506
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.5e-61
Family TK-like Pyr module 0.012
Further Details:      
 
Domain Number 3 Region: 492-626
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.36e-37
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0C8J3
Sequence length 635
Comment (sp|B0C8J3|DXS_ACAM1) 1-deoxyxylulose-5-phosphate synthase {ECO:0000255|HAMAP-Rule:MF_00315} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_5186; OC=Acaryochloris.
Sequence
MHLSEIVHPNQLHGLSISELKQIANQIREKHLDTVATSGGHLGPGLGVVELTLALYQTLD
LDQDKVVWDVGHQAYPHKLITGRYERFHTLRQKDGVAGYLNRRESKFDHFGAGHASTSIS
SVLGMALARDAKGENFKTVAVIGDGAMTGGMALEAINHAGHLPHTRMLVILNDNDMSISP
NVGAMSRYLNKMRLSPPIQFLSDNFEEQLKQLPFGEQVAPDLKRLKGGMKRLAVSKVGAV
FEELGFTYIGPVDGHSLEELLATFKEAHLHEGPVLVHVATTKGKGYAIAEQDQVSYHAQS
PFNLETGKAKPSNKPKPPSYSKVFAETLIKMAENDIRVVGITAAMATGTGLDKLQAKLPK
QYIDVGIAEQHAVTLAAGMACEGMRPVVAIYSTFLQRGYDQIIHDVCIQNLPVFFCLDRA
GIVGADGPTHQGMYDIAYLRCLPNMVMMAPKDEAELQQMLVTGINYTDGPIAMRYPRGSG
LGVGLMEEGWEPLPIGKAETLRHGDDVLLLAYGTMVNLASQVADMLTEHGVRATVVNARF
AKPLDTELIIPLAQKIGQVVTLEEGCLPGGFGSAVLEALMDHQVMAPVTRIGVPDQLVEH
ATPDQSKAELGLTPAQVAERVLGLLKQKPAPSYVS
Download sequence
Identical sequences B0C8J3
329726.AM1_5186 gi|158338290|ref|YP_001519467.1| WP_012165409.1.67183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]