SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0CEU2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0CEU2
Domain Number 1 Region: 40-284
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.12e-80
Family Tryptophan biosynthesis enzymes 0.0000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0CEU2
Sequence length 303
Comment (sp|B0CEU2|TRPC_ACAM1) Indole-3-glycerol phosphate synthase {ECO:0000255|HAMAP-Rule:MF_00134} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_4360; OC=Acaryochloris.
Sequence
MQIRRRPPSVAVNVQELQYQVKTPENEPRNILEKIVWFKETEVEQMRDSVSLLDLRKQVA
NCEPPLSFLDALKHGKTQPALIAEVKKASPSKGVLRENFDPVAIAQAYEAAGASCLSVLT
DAEFFQGSFDYLQQIRAAVSLPLLCKEFVIYPYQIYLARSRGADAVLLIAAILSDQDLTY
FLKIIKSLGMTALVEVHTLPELERVMDIPGIELIGINNRDLETFTVDLEVTCQLLAQQGT
SLQDQDILVVSESGLHTSADLAQVKQAGAGAVLIGESLVKETGNASTHSETEQMQAKISA
LFS
Download sequence
Identical sequences B0CEU2
329726.AM1_4360 WP_012164664.1.67183 gi|158337481|ref|YP_001518656.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]