SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0CEU9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0CEU9
Domain Number 1 Region: 7-234
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.61e-65
Family Decarboxylase 0.00000504
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0CEU9
Sequence length 240
Comment (tr|B0CEU9|B0CEU9_ACAM1) OMP decarboxylase {ECO:0000256|HAMAP-Rule:MF_01200} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_4367 OC=Acaryochloris.
Sequence
MTTEIAQRIIVPLDVPSEADAIALIDQIPQVQFWKVGLELFVSCGPSILEQLKQRQKKVF
LDLKFHDIPNTVAGACRSAATYGVDLLTIHATAGRPALSAAQQALQEGAQSAQTAPPKLI
AITVLTSLSLRELALDLKIPLELPEYALQMGLLAQESGLNGIVCSPHEAEQMRQVCGDEF
LIVCPGVRPPGSVTGDQKRAMTPTAAMQAGANYLVIGRPITTATDPQQAFQQICTDLVSA
Download sequence
Identical sequences B0CEU9
gi|158337488|ref|YP_001518663.1| WP_012164671.1.67183 329726.AM1_4367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]