SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0CF40 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0CF40
Domain Number 1 Region: 5-241
Classification Level Classification E-value
Superfamily PP2C-like 6.8e-62
Family PP2C-like 0.0000239
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0CF40
Sequence length 269
Comment (tr|B0CF40|B0CF40_ACAM1) Serine/threonine protein phosphatase 2C {ECO:0000313|EMBL:ABW30556.1} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_5605 OC=Acaryochloris.
Sequence
MKRLFAGLSDQGLVRKANQDSYRIDEPEGRFFIVADGMGGHAGGEEASRIAAETIQKFLV
ENWQAQLNPPDLLKKALLKANQDIIQNQKDFPERADMGTTVVVVLFPAEGQPWCAHIGDS
RLYRWRGSQLSQITEDHTWISQAVKSGLLTKDQARSHPWRHVLAQCLGREELDEIGIQQL
DVKSGDQLLLCSDGLTEELADEQIAPFFEAKHPCETVVDALVEAAKDEGGQDNITVVLVA
LGDGEEEESSSWADTPAMDDDPTGDLNEA
Download sequence
Identical sequences B0CF40
329726.AM1_5605 WP_012165776.1.67183 gi|158338698|ref|YP_001519875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]