SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0CG05 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0CG05
Domain Number 1 Region: 11-385
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.3e-112
Family GABA-aminotransferase-like 0.000000307
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0CG05
Sequence length 391
Comment (tr|B0CG05|B0CG05_ACAM1) Aminotransferase, DegT/DnrJ/EryC1/StrS family {ECO:0000313|EMBL:ABW29452.1} KW=Complete proteome; Reference proteome OX=329726 OS=Acaryochloris marina (strain MBIC 11017). GN=AM1_4475 OC=Acaryochloris.
Sequence
MPRSKDQFLVFGSPAIEEAEMQEVMASMRTGWLGTGPKVMRFEQDFCTYKGSQHAIAVNS
CTAALHLSLLAAGLNPGDEVITTPLTFCATANAIIHAGGVPVLADVDPETMNIDPAQVEA
KITDRTKAIIPVHFAGRPCEMDALCALAEQYSLVLIEDCAHAIETEYQGRKAGTFSNFGC
FSFYVTKNITTGEGGMILTQTQEDTDRIKVLALHGMSQDAWKRFSDDGYNHYQVVEAGFK
YNMMDIQAAIGIHQLQRVTPYWNRRQQIWQQYNQALADLPLTLPTPPAPNTVHGYHLYTL
LIDESQTGISRDQFLVAMHRQHIGTGVHYLSLPEHPYYQHRFGWQPQDYPHATRIGQQTV
SIPLSAKLNDLDVEDVVAAVHQSLDTSAIAA
Download sequence
Identical sequences B0CG05
WP_012164767.1.67183 gi|158337594|ref|YP_001518769.1| 329726.AM1_4475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]