SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0CM75 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0CM75
Domain Number 1 Region: 6-124
Classification Level Classification E-value
Superfamily PX domain 1.83e-24
Family PX domain 0.002
Further Details:      
 
Domain Number 2 Region: 264-339
Classification Level Classification E-value
Superfamily MIT domain 1.31e-16
Family MIT domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0CM75
Sequence length 342
Comment (tr|B0CM75|B0CM75_PAPAN) Sorting nexin-15 (Predicted) {ECO:0000313|EMBL:ABY63648.1} KW=Complete proteome; Reference proteome OX=9555 OS=Papio anubis (Olive baboon). GN=BB_r332_jsm6F087f OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MSRQAKDDFLRHYTVSDPRTHPKGYTEYKVTAQFISKKDPEDVKEVVVWKRYSDFRKLHG
DLAYTHRNLFRRLEEFPAFPRAQVFGRFEASVIEERRKGAEDLLRFTVHIPALNNSPQLK
EFFRGGEVTRPSEMSRDLHILPPPLIPTPPPDDPRLPQPLPAERRGLEELEVPVDPPPSS
PAQEALDLLFNCESTEEASGSPARGPLTEAELALFDPFSKEEGAAPSPTHVAELATMEME
SARLDQEPWEPGGQEEEEDGEGGPTPAYLSQATDLITRALRDEKAGAYAAALQGYRDGVH
VLLQGVPSDPLPARQEGVKKKAAEYLKRAEEILHLHLSQLPP
Download sequence
Identical sequences B0CM75
ENSPANP00000005347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]