SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0CM83 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0CM83
Domain Number 1 Region: 1054-1192
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.89e-22
Family Synaptotagmin-like (S variant) 0.044
Further Details:      
 
Domain Number 2 Region: 424-518
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.34e-21
Family Canonical RBD 0.00000253
Further Details:      
 
Domain Number 3 Region: 547-631,853-930
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.46e-20
Family Canonical RBD 0.0000147
Further Details:      
 
Domain Number 4 Region: 1210-1412
Classification Level Classification E-value
Superfamily vWA-like 1.14e-19
Family Integrin A (or I) domain 0.019
Further Details:      
 
Domain Number 5 Region: 941-1059
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.64e-17
Family Synaptotagmin-like (S variant) 0.073
Further Details:      
 
Domain Number 6 Region: 296-385
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.71e-16
Family Canonical RBD 0.0034
Further Details:      
 
Domain Number 7 Region: 4-87
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000611
Family Canonical RBD 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0CM83
Sequence length 1466
Comment (tr|B0CM83|B0CM83_PAPAN) RNA binding motif protein 12 (Predicted) {ECO:0000313|EMBL:ABY64675.1} OX=9555 OS=Papio anubis (Olive baboon). GN=RBM12 OC=Catarrhini; Cercopithecidae; Cercopithecinae; Papio.
Sequence
MAVVIRLQGLPIVAGTMDIRHFFSGLTIPDGGVHIVGGELGEAFIVFATDEDARLGMMRT
GGTIKGSKVTLLLSSKTEMQNMIELSRRRFETANLDIPPANASRSGPPPSSGMSGRVNLP
TTVSNFNNPSPSVVTATTSVHESNKNIQTFSTASIGTAPPNMGASFGSPTFSSTVPSTAS
PMNTVPPPPIPPIPAMPSLPPMPSIPPIPVPPPVPTLPPVPPVPPIPPVPSVPPMTPLPP
MSGMPPLNPPPVAPLPAGMNGSGAPMNLNNNLNPMFLGPLNPVNPIQMNSQSSVKPLPIN
PDDLYVSVHGMPFSAMENDVRDFFHGLRVDAVHLLKDHVGRNNGNGLVKFLSPQDTFEAL
KRNRMLMIQRYVEVSPATERQWVAAGGHITFKQNMGPSGQSHPPPQTLPRSKSPSGQKRS
RSRSPHEAGFCVYLKGLPFEAENKHVIDFFKKLDIVEDSIYIAYGPNGKATGEGFVEFRN
EADYKAALCRHKQYMGNRFIQVHPITKKGMLEKIDMIRKRLQNFSYDQREMMLNPEGDVN
SAKVCAHITNIPFSITKMDVLQFLEGIPVDENAVHVLVDNNGQGLGQALVQFKNEDDARK
SERLHRKKLNGREAFVHVVTLEDMREIEKNPPAQGKKGLKMPVPGNPAVPGMPNAGLPGV
GLPSAGLPGAGLPSTGLPGSAITSAGLPGAGMPSAGIPSAGGEEHAFLTVGSKEANNGPP
FNFPGNFGGSNAFGPPIPPPGLGGGAFGDARPGMPSVGNSGLPGLGLDVPGFGGGPNNLS
GPSGFGGGPQNFGNGPGSLGGPPGFGSGPPGLGSAPGHLGGPPAFGPGPGPGPGPGPIHI
GGPPGFASSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEA
MVAFESRDEATAAVIDLNDRPIGSRKVKLMAHCVTLVQLSISCDHLIDKDIGSKSDPLCV
LLQDVGGGSWAELGRTERVRNCSSPEFSKTLQLEYHFETVQKLRFGIYDIDNKTPELGDD
DFLGGAECSLGQIVSSQVLTLPLMLKPGKPAGQGTITVSAQELKDNRVVTMEVEARNLDK
KDFLGKSDPFLEFFRQRDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGDPSTPIEVR
CSDYDSDGSHDLIGTFHTSLAQLQAVPAEFECIHPEKQQKKKSYKNSGTICVKICRVETE
YSFLDYVMGGCQINFTVGVDFTGSNGDPSSPDSLHYLSPTGVNEYLMALWSVGSVVQDYD
SDKLFPAFGFGAQVPPDWQVSHEFALNFNPGNPYCAGIQGIVDAYRQALPQVRLYGPTNF
APIINHVARFAAQAAHQGTASQYFVLLLLTDGAVTDVEATREAVVRASNLPMSVIIVGVG
GADFEAMEQLDADGGPLHTRSGQAAARDIVQFVPYHRFQNAPREALAQTVLAEVPTQLVS
YFRAQGWAPLKPLPPSAKGPAQAPQA
Download sequence
Identical sequences B0CM83
ENSPANP00000016746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]