SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0D132 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0D132
Domain Number 1 Region: 19-114
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.1e-23
Family Thioltransferase 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0D132
Sequence length 122
Comment (tr|B0D132|B0D132_LACBS) Glutaredoxin {ECO:0000313|EMBL:EDR11931.1} KW=Complete proteome; Reference proteome OX=486041 OS=deceiver) (Laccaria laccata var. bicolor). GN=LACBIDRAFT_324212 OC=Laccaria.
Sequence
MSIYAAGEIDLDWERETRFLNKQYPIVVFSKTYCPYSKRAKELLAAYNIQPTPKIVEVDM
RDDNNVIKLLLSRLTHHSTFPNILIQGKSIGGSDDLIALHNDRTLAKMLERAGVTIQSDL
EF
Download sequence
Identical sequences B0D132
29883.JGI324212 jgi|Lacbi1|324212|fgenesh3_pg.C_scaffold_5000319 XP_001877828.1.58555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]