SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0E213 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0E213
Domain Number 1 Region: 49-184
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.53e-19
Family Glutathione peroxidase-like 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0E213
Sequence length 184
Comment (tr|B0E213|B0E213_LACBS) Peroxiredoxin {ECO:0000313|EMBL:EDQ99091.1} KW=Complete proteome; Reference proteome OX=486041 OS=deceiver) (Laccaria laccata var. bicolor). GN=LACBIDRAFT_241727 OC=Laccaria.
Sequence
MASAIATIAHAAHNVASSLIADAQIQPGAVIPAQEIKEDAPDKTSALVLTGKNIIIGVPG
AFTTPCNAHIPAYIETYEEFKNKGINEIYVVGVNDVFVTNDFSKIFEDDYLSPFKYVAIH
FIADDKAAFIGSLGLLFDATPLLGGQRSKRFVIVTEGDKVLSVAVEVAPPDVTITAAKAV
LAQL
Download sequence
Identical sequences B0E213
jgi|Lacbi1|241727|e_gwh1.83.13.1 XP_001890224.1.58555 29883.JGI241727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]