SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0EBS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0EBS5
Domain Number 1 Region: 593-729
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.47e-17
Family Ricin B-like 0.016
Further Details:      
 
Domain Number 2 Region: 732-810
Classification Level Classification E-value
Superfamily RPA2825-like 0.00000628
Family RPA2825-like 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0EBS5
Sequence length 816
Comment (tr|B0EBS5|B0EBS5_ENTDS) Uncharacterized protein {ECO:0000313|EMBL:EDR28018.1} KW=Complete proteome OX=370354 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760). GN=EDI_278730 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MHSQSIPLFKDNNDISKGLSDQFRNIISHCNKPHFICICNDQGSNENININQIINGISSN
DYFHLQEPLKVSNETSTSETNKCNIIGPIIVSDIVKRNNLEEQEFQQILNDEVFFIEITK
LKLTSSTTLNNITGILSILQLSSVRIIHNTNEINASVLEDISSIDNLSCLLQLQGIRKEG
KRVICISSDIKTTTEKEDELTLKETILNKQKHINNHLVNFFSTKPHQTDCLCFLLPSCCP
VSQSQILCKFYKEQMRNIICEILHEIPSNCKSGSYVLSCIEILIECFKSINELNTNNIFN
EIKRLLKKKYVTTINSINMKLVGMFYEMSLDERITIIEDQSKIKNLVYQIIEKEFNPIWD
VLQIIYGDQLTNELFDSISITSKYLEEFILKDTQKIIDDLIHCNSFRLTPMWTYLTQIQI
KEQFEQNKYDSLINNYLTQTLTLNQKTLQFYSNKKCTRIDELKHQCIETIKLKTNEILNG
KQQWRDVCIKIQNYYHNLITTIDKELQTKDLSTVHQVELYHQYYLGFFKSNSEMYTVQNK
QIIFNQNDYNKILQDTFNELNDLFDKKKQIAQTLEQNHLKEELERKKEAFIRKLTSKSYY
IMPCCTTRFVLDAKYSDFKNGQPINLYWSHGNQNQHFQFIQKNDSFQIKIGHNGFLVHRS
DVSEGSVIHQWNDTTNINSFWKVIENNDGTISFLSVSNEFLAFTADSNELLASCHTRHFT
CSDYQKFKLLDTPLNNQPVPPPPENQETPKHQAQLFQTPRYAGPSIVDALKSIHADSSFS
YRERIAQVNNIQGYRGTGPQNDHMRKLLYQGRLIKP
Download sequence
Identical sequences B0EBS5
jCVI|EDI_278730 gi|165902109|gb|EDR28018.1| gi|167381564|ref|XP_001735769.1| XP_001735769.1.18373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]