SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0EMB6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0EMB6
Domain Number 1 Region: 347-545
Classification Level Classification E-value
Superfamily HCP-like 5.14e-23
Family HCP-like 0.0011
Further Details:      
 
Domain Number 2 Region: 7-212
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.51e-18
Family Calponin-homology domain, CH-domain 0.0013
Further Details:      
 
Domain Number 3 Region: 637-760
Classification Level Classification E-value
Superfamily HCP-like 1.7e-16
Family HCP-like 0.0062
Further Details:      
 
Domain Number 4 Region: 553-634
Classification Level Classification E-value
Superfamily HCP-like 0.00000034
Family HCP-like 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0EMB6
Sequence length 773
Comment (tr|B0EMB6|B0EMB6_ENTDS) Uncharacterized protein {ECO:0000313|EMBL:EDR24334.1} KW=Complete proteome OX=370354 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760). GN=EDI_070760 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MEDPHICILTNWLNYTLKLCDEKKVSYSSFRDGVLLTILFNKLNNITSKPIKLPQTPADK
INNNQQIINIVYDGANKISAERFTLGVPEAVTPLLIKMFLKYQLKCSSIQEAIDKILDMV
QGVTGKEVIDLSLSWVDGIIFNQFLAGLQPETNNPFPNLNNLTSVKLIQHCLEYAENTFG
VPPLITAEDMCNLQEQFSLVVYLSYFMNYAKKVPRKHVIIMDEAKSNKIKKIIDDPEQEL
DFKTSGYADVEEQLNKEAEPRIEENNEDSHYSPSFQIHILEKLNLYRNPREKEDADSWKL
INKFSYWIEPIMSNFLYESPMILYSPQQQTEEERKKILVTDKTRPETFFKLASCYFQGIL
VEKNEKLAYKFFKYGARYGDVNSINNIGLMKERGIGCIQDKYVAKEKYSEAMNKGCIMAC
NNLAVLQMIEGDVKKAITNWKFAITNNIVAACNNLGVALIQSDPGKAINLLLEGYKYNDK
YATYNLGVVTLKGIPKHIPQNLRIAAILFQNSISLPYSRFNVAFMQYTGIGLQKNLHEAA
KNYALSRCSKTHSDVNLAIGLLYGHFGVKLKDNYEVATKILLAQRNSSVATFHLGMCYRK
GMGVYENSIKSAEMYKLSMKLGNEFAKFHVGCVKMIKHENREEAVSLIKEAVDAGYWVAE
SWYGRFIYANNQREGLKLIHKACLMEDKRALYALAIHSLKNQDVNYAIKILLNLCKSSYV
DAIVTVGVCFMKGVGVKKDVNLACMFWRKAKVLGSEKAVQFLQQCYSDDEFNY
Download sequence
Identical sequences B0EMB6
gi|165897066|gb|EDR24334.1| gi|167390305|ref|XP_001739292.1| jCVI|EDI_070760 XP_001739292.1.18373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]