SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0EUA6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0EUA6
Domain Number 1 Region: 81-217
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.81e-22
Family PWWP domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0EUA6
Sequence length 335
Comment (tr|B0EUA6|B0EUA6_ENTDS) Uncharacterized protein {ECO:0000313|EMBL:EDR21895.1} KW=Complete proteome OX=370354 OS=Entamoeba dispar (strain ATCC PRA-260 / SAW760). GN=EDI_146030 OC=Eukaryota; Amoebozoa; Archamoebae; Entamoebidae; Entamoeba.
Sequence
MEEEKQVDTTTVQSSTPPMSPQHSHSITPSASPKENKVSTPLSPDREDGGVTTPTPSKKE
EETKPKKSSNESVTVIDKDVEQNKWNNWSVVWVKQKGYPWWPAKIIIMDKLNEKKKRQLE
KLIEFKKDKKYLVKYITNGYQFGWVNDSQIKPFKEEFMNVITERMLGKKDIVESINKAIE
IANDKISENDIDKFHKAVIKKEKQMEEEEKKKEKMRNCDIGFMVVSDPMIEITKIEGIVE
KNIENNNSSLQKLKNWKEMEYCQIVEELNKLMKEPIMIHEIINPINKVGELLNSICQSTN
IEISVLAERVLERIKKELKYAIVSGEYQRCKEIFN
Download sequence
Identical sequences B0EUA6
jCVI|EDI_146030 XP_001741636.1.18373 gi|165893760|gb|EDR21895.1| gi|167395562|ref|XP_001741636.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]