SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0I4W7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0I4W7
Domain Number 1 Region: 3-279
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 2.14e-67
Family Carbon-carbon bond hydrolase 0.00000722
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0I4W7
Sequence length 282
Comment (tr|B0I4W7|B0I4W7_9ACTN) 2-hydroxy-6-(2-hydroxyphenyl)-6-oxo-2,4 hexadienoic acid hydrolase {ECO:0000313|EMBL:BAG06221.1} OX=490627 OS=Nocardioides sp. DF412. GN=dfdC OC=Nocardioides.
Sequence
MTLDPHSISKTVRTKDWSIHYNEAGPADGHPVVLLHGGGPGATGWSNYSPNIEALARHFR
VIAPDMPGWGDSDAVDFATLDHVEALCQLLDQLGIERAALVGNSMGGHTSIRTAIERPER
VSHLITMGAPLQMKPILFGAGGGPSEGLKIMYAGFGDASPAAMRRLVEIMVFDQARFATP
ELCEQRSQAALKRPEHLANIAKAAPRAPIPIWADPARLGEITAPALLVHGRDDRVVTFET
ALFLAANIPDSRAHLINRCGHWAQLEHADEFNRLVTDFVLNH
Download sequence
Identical sequences B0I4W7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]