SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0JG00 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0JG00
Domain Number 1 Region: 89-193
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000142
Family Galactose-binding domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0JG00
Sequence length 242
Comment (tr|B0JG00|B0JG00_MICAN) Uncharacterized protein {ECO:0000313|EMBL:BAG02005.1} KW=Complete proteome; Reference proteome OX=449447 OS=Microcystis aeruginosa (strain NIES-843). GN=MAE_21830 OC=Microcystaceae; Microcystis.
Sequence
MTNNILSRVTVFTTTATLILYCNINPAKATNIQGAISVSTNLGVGSSEFDISNIINKSGL
FIPYTNGQDLNGYLAQNPFHTYVGQNNDWFSGFNAASILPGIVDFNLGSLFSITDFVLWN
GDAAGIQNFDLVVSSVSDFSSFTSVGSFVANFNPNGVSYLPQRFSFSPANAQFVRLKINT
SYPFTNGFISIGESAFGVGTKSIPESSSVLGLLALGTLGVGSLIKSKVMGKKPKNDSQEV
EN
Download sequence
Identical sequences B0JG00
gi|166364924|ref|YP_001657197.1| 449447.MAE_21830 WP_012265390.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]