SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0JH16 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0JH16
Domain Number 1 Region: 1494-1719
Classification Level Classification E-value
Superfamily beta-Roll 3.53e-30
Family Serralysin-like metalloprotease, C-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 1357-1466
Classification Level Classification E-value
Superfamily CalX-like 6.93e-24
Family CalX-beta domain 0.0034
Further Details:      
 
Domain Number 3 Region: 1134-1245
Classification Level Classification E-value
Superfamily CalX-like 2.22e-20
Family CalX-beta domain 0.0031
Further Details:      
 
Domain Number 4 Region: 1243-1356
Classification Level Classification E-value
Superfamily CalX-like 6.15e-20
Family CalX-beta domain 0.0049
Further Details:      
 
Domain Number 5 Region: 930-1101
Classification Level Classification E-value
Superfamily beta-Roll 0.000000000061
Family Serralysin-like metalloprotease, C-terminal domain 0.0039
Further Details:      
 
Domain Number 6 Region: 442-587
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000785
Family Serralysin-like metalloprotease, C-terminal domain 0.0018
Further Details:      
 
Domain Number 7 Region: 615-772
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000235
Family Serralysin-like metalloprotease, C-terminal domain 0.0034
Further Details:      
 
Domain Number 8 Region: 791-939
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000262
Family Serralysin-like metalloprotease, C-terminal domain 0.0035
Further Details:      
 
Domain Number 9 Region: 195-246,285-315,354-414
Classification Level Classification E-value
Superfamily beta-Roll 0.000000068
Family Serralysin-like metalloprotease, C-terminal domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0JH16
Sequence length 1748
Comment (tr|B0JH16|B0JH16_MICAN) Uncharacterized protein {ECO:0000313|EMBL:BAG02168.1} KW=Complete proteome; Reference proteome OX=449447 OS=Microcystis aeruginosa (strain NIES-843). GN=MAE_23460 OC=Microcystaceae; Microcystis.
Sequence
MASNTLVPIIIDEGLLLDSLPRVGGSLFYVLETAWSSVTERLRDFARSPEFAAKMELAFG
QDVNVSELQTAWAAGDFSKLPRIEVRLRSHLNGANGAYAAALDRIFISEEFLNQNAGNMG
AASLTARVILEEIGHAVDGRLNESDSPGDEGAIFAALVLGESLDAKTLQALKAEDDTGVI
NLNGQIVAVEMQDFTGTNGNDNIIGTAGDDTISPLRGKDAVDGGEGNDLLIVDYSSNLYA
GTATYPSGIVVSSLGSNGNGGWNGNLYAYTRNDGDYDVVNFTNIERFQIKGTNVNDTFDR
GGYGVFNLDGGAGTDIIRYADFGSETAGLTVDNSGITLTQANGNVVKNVEVFANLSTGSG
NDTINYSVGLRNYENINTGAGDDTINPGRGQDTVDGGEGNDLLIVDYSSNLYAGTTTYPS
GFLGHAINPNGTGGWNGIFAAYTRNDGDSDHVFFSNIERFQIKGTNVNDIFDRGGYGVFN
IDGGAGTDIIRYADFSSETTGLTVDNSGITLTQANGNVVKNVEVFANLSTGSGNDTINYS
VGLRNYENINTGAGDDTINPGRGQDTVDGGEGNDLLIVDYSSNLYAGTTTYPSGFLGHAI
NPNGTGGWNGIFAAYTRNDGDSDHVFFSNIERFQIKGTNVNDIFDRGGYGVFNIDGGAGT
DIIRYADFGSETAALTVDNSGVTLTQANGNVVKNVEVFANLWTGTGNDTINYSVGLRNYE
NINTGAGNDTINTGSGRDTVDGGAGNDLLIVDYSSNLYAGNATYSGGIGSSINPNGFGGW
NGYFYAYSRNDGDYDNVTFSNIERFQITGTNFNDTFDRGGYGVFNIDGGTGTDVIRYADL
SSETTGLTVDNSGITLTQANGNVVKNVEVFANLWTGTGNDTINYSVGLRNYENINTGAGN
DTINTGSGRDTVDGGAGNDLLIVDYSSNLYAGNATYSGGIGSSINPNGFGGWNGYFYAYS
RNDGDYDNVTFSNIERFQITGTNFNDSLNTGDGDDIITGGMGNDTLNVRNGNDILIGVDP
NSSNPGRGEIDSFTGGLGRDRFILGDVSWLGYDDGDSTLAGNNDYAQISDFNPTDDIIQL
RGTSSNYLLMVSGTDTQLYLDKPGSEPDELIAILQNRTGLSLTGSYFNYFSALPNITLAI
NPASVNEDGTPNLIYTFTRDGSLTNPLTVNYTIGGTATNGTDYGNIGTSVTFTANSSTAT
VTVNPTADTVLESDETVDITLGSGTGYTIGTTTAVTGTILNDDLPSITLAVNPLSVNEDG
TTNLIYTFTRDGSLTNPLTVNYTIGGTATKGTDYANIGTSVTFAQNSAIATVTVDPKADA
TVESNETVALTLAPGTGYKIGTTTAVTGTILNDDPAPATALSINDLTVIEGKDTRAILTV
SLSSLSSKSISVNYTTTPINATANSDYTHQTGTLTIAANSSIGTIFIPILNDNLNEVDEA
FTVTLSNPINATLSADSVGEVIITDTWQSNITRTLPSGVENLRLIGDNPINGTGNAGNNV
LTGNSANNTLAGLAGNDAYVFTANSYLGLDTISETTTGGIDTLNLSGTNNPIRLNLGSIS
NQTVVTGNLTLKLSAVNVIENAFGGSGNDRITGNSLSNALNGGPGNDTLSGGAGNDILTG
NQADDILVGGVGNDRFSYLTGRAFMASDIGLDTLTDFTPNADKLSLSKTTFSALTSTVGN
GFSQATDFAIVEDDALVETSAAFIVYSSNSGSLFYNENGSAIGLGTGVEFAVLVGSPALT
ASDFTLVA
Download sequence
Identical sequences B0JH16
449447.MAE_23460 gi|166365087|ref|YP_001657360.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]