SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0JIW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0JIW0
Domain Number 1 Region: 1088-1308
Classification Level Classification E-value
Superfamily beta-Roll 2.01e-24
Family Serralysin-like metalloprotease, C-terminal domain 0.00039
Further Details:      
 
Domain Number 2 Region: 165-553,580-598
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.49e-23
Family Pectate transeliminase 0.048
Further Details:      
 
Domain Number 3 Region: 719-827
Classification Level Classification E-value
Superfamily CalX-like 3.14e-23
Family CalX-beta domain 0.0034
Further Details:      
 
Domain Number 4 Region: 605-716
Classification Level Classification E-value
Superfamily CalX-like 1.7e-18
Family CalX-beta domain 0.0044
Further Details:      
 
Domain Number 5 Region: 927-1088
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000000256
Family Serralysin-like metalloprotease, C-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0JIW0
Sequence length 1318
Comment (tr|B0JIW0|B0JIW0_MICAN) Uncharacterized protein {ECO:0000313|EMBL:BAG05668.1} KW=Complete proteome; Reference proteome OX=449447 OS=Microcystis aeruginosa (strain NIES-843). GN=MAE_58460 OC=Microcystaceae; Microcystis.
Sequence
MTSTLLPILPAVDDVLFNFAQSDGFWVNLETAFGTSYDVVKATQLRQQWQSRNFSQLPPI
EVLSDEVLGTANGAYSSSKNKIYLSASFLNTASSATIINVILEEIGHYVDAQINQVDSAG
DEGEYFAALVRGVDLTTQEVARITTENDFANITITGNDVPVEKSAPTILTVNTTADQNDG
NADNGLSLRDAILIANANPNTEYEIHLTGGLTYTLTSNGVNENEGKKGDLDIKSRNNVLY
IGAFNGQKATIDASGLLNSDRVFHVLSGGALSLQNVVVTGGIISSSGAGISVNATGVLDL
YNTTVSGNKALGSSSNGGGIQNRGFVYLRQGSVVSNNIASGSSFQEGGGVDNSGGTLIAI
NSTINNNQGGVYGGGISSVAGSLTLINTTVSGNSAGNGGGITNNGTSMALINTTVSGNNA
SYAGGGIYSSGDTFNLINSTITNNTVVDTQFVGRRGGGGIYSLGTTFFLKNTIVAGNIDN
TTNGFDLLSSGLSGAIFNGNNYNLIGDLTGAKGTIGTGTDIVNSNPGLAPLANYGGLTLT
HALLAGSPAINAGNNSLILVDSEDIDGDGDTTEQIPFDQRGTGFNRIFGGTVDIGAFEEQ
GTIVVISLAVSPASVNEDGTTNLVYTFTRSGVTTNSLTVNYTLGGTATLNTDYTRTGTTN
TVTFAANSSTATVTVDPTADTTVENNETVALTLASGTGYTVGTATAVTGTITNDDFSKLS
INNITVVEGKDNNAILTVTVDNPNSQPITFNYTTAPINATANVDYTSKTGTITIAPNTST
ATITIPILNDNLNEANETFAINLSNPINATLTNNKGIVTISDTLTANVTTTLPANVENLT
LTGTTNINGTGNAANNIITGNSGNNILNGGTGIDTLIGGLGNDTYQVDTTTDTITENANQ
GTDTVQSSVTYTLGNNLENLTLTGTANINGTGNTLNNIITGNSGNNILNGATGIDTLIGG
LGNDTYQVDTTTDTITENANQGTDTVQSSVTYTLGNNLENLTLTGTANINGTGNTLNNII
TGNSGNNILNGATGIDTLIGGLGNDTYQVDTTTDTITENANQGTDTVQSSVTYTLGNNLE
NLTLTGTANINGTGNTLNNIITGNSGNNILNGATGIDTLIGGLGNDTYQVDTTTDTITEN
ANQGTDTVQSSVTYTLGNNLENLTLTGTANINGTGNTLNNIITGNSGKNTLTGSAGNDTL
IGGTGNDTITGGAGGDRFTFKNPNQGIDTITDFLSSQGDKITVSAAGFGGGLAAGVAITA
AQFVLGTTALNASNRFIYNTITGGLFFDGDGTGTLAAIQIATLSSKPTLTASNILVLV
Download sequence
Identical sequences B0JIW0
449447.MAE_58460 gi|166368587|ref|YP_001660860.1| WP_012268045.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]