SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0JJF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0JJF6
Domain Number 1 Region: 6-192,314-391
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.07e-24
Family Thi4-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0JJF6
Sequence length 598
Comment (tr|B0JJF6|B0JJF6_MICAN) Uncharacterized protein {ECO:0000313|EMBL:BAG02598.1} KW=Complete proteome; Reference proteome OX=449447 OS=Microcystis aeruginosa (strain NIES-843). GN=MAE_27760 OC=Microcystaceae; Microcystis.
Sequence
MVTTDTKVYDVVIMGAGFAGVCQARHLLLNVPNIKIALIDPRPEERTNKDLKIGESMVEI
ATLFVCKELGLYEYMIENHPPKFGLNFHWPKKKDKTTTTDDYYHIWNNRQPPLASFQMNR
AKFERDLLKMNKAMGATFYQGRVVDVDLTSKDELKTVIAKVENEQITLKAKHVIDAAGRK
FIIGQKTDNLLFGADNLFGLDTGSVWVRVNNIDRTIFHDGYDPYGTTCSHYYATNHWFGH
GHWLWMIPTEKDSQEISIGIAYHRSAIADKQINTKEKFYAFLKANHEILYRLVNSGENID
FHYLPRPSHTSKTMFSADNWYVIGDAACIFDPFYSLGSSMISYQIECTTEIIRSKLVGEA
IGEKKQAAYNDFILTYTRFNNHLIKHHDQQLGDASIMSWRIYHDYIWWFGVQVPMYTGKW
FLDLDFLTRYTPGLKEHQMGYCEHLYQQFNEVIAQGKNLGFMDCHRGDQLWGDYHTLKHF
DDFVENAKLEPRRCNVFACMKTTNFYTAIWYANFLWKGFGVTAFVKPKNLFYLLKHLQGV
IQADIAERVYKHFTKGIPSNRKIAEMRQEFTTYHYQPELNSWEQETAPLASQKITVTV
Download sequence
Identical sequences B0JJF6
gi|166365517|ref|YP_001657790.1| 449447.MAE_27760 WP_012265829.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]