SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0JJL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0JJL8
Domain Number 1 Region: 2-261
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.65e-61
Family Decarboxylase 0.0007
Further Details:      
 
Domain Number 2 Region: 286-472
Classification Level Classification E-value
Superfamily PRTase-like 3.63e-38
Family Phosphoribosyltransferases (PRTases) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0JJL8
Sequence length 477
Comment (tr|B0JJL8|B0JJL8_MICAN) Orotate phosphoribosyltransferase {ECO:0000256|HAMAP-Rule:MF_01208} KW=Complete proteome; Reference proteome OX=449447 OS=Microcystis aeruginosa (strain NIES-843). GN=MAE_28380 OC=Microcystaceae; Microcystis.
Sequence
MNFFQKLNHAISQNQTLLVLGLDANPEMMPSTPGELIVNLEQWLKFIIDETAPFVCAYKP
TLGFYQALGSAGLELLQRILTAIPPHIPVILDAKHGDINTSSVLAETIFKTWQVDAVTLN
PYSGQDHVAPFLVYPEHGAFILCHTSNQGAINLQEFPSCDNPFYLQVVKEACTWGTPEQV
FLEVGTTQPEILKKIRNFAPERLILLRSIWEDKSKFSELITVGLNSHGEGLLIPVPQDFL
SQPDLGAKVKDLREEVNKIQQNHQQESSGDDTWTANVCLLKQHPHQDLILQLFDIGCLMF
GDYVQASGETFSYYIDLRKIISNPNIFQQVIEAYGEILKTLTFDRIAGIPYGSLPTATGL
SLLLNHPMIFPRKEVKAHGTRRVIEGNFQVGETVVVVDDILISGKSAIEGAAKIKSAGLL
VNDIVVFIDHGGPVKDKLRSHGYQAYSVLTLAEITDTLYEAGRLTEAEYSCFLNRSH
Download sequence
Identical sequences B0JJL8
449447.MAE_28380 WP_012265870.1.4043 gi|166365579|ref|YP_001657852.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]