SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0JJN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0JJN8
Domain Number 1 Region: 845-961
Classification Level Classification E-value
Superfamily CalX-like 1.44e-26
Family CalX-beta domain 0.0024
Further Details:      
 
Domain Number 2 Region: 965-1054
Classification Level Classification E-value
Superfamily CalX-like 1.28e-22
Family CalX-beta domain 0.0027
Further Details:      
 
Domain Number 3 Region: 733-844
Classification Level Classification E-value
Superfamily CalX-like 2.22e-19
Family CalX-beta domain 0.0041
Further Details:      
 
Domain Number 4 Region: 349-546
Classification Level Classification E-value
Superfamily beta-Roll 2.88e-19
Family Serralysin-like metalloprotease, C-terminal domain 0.0011
Further Details:      
 
Domain Number 5 Region: 259-402
Classification Level Classification E-value
Superfamily beta-Roll 5.89e-19
Family Serralysin-like metalloprotease, C-terminal domain 0.0015
Further Details:      
 
Domain Number 6 Region: 503-699
Classification Level Classification E-value
Superfamily beta-Roll 4.97e-18
Family Serralysin-like metalloprotease, C-terminal domain 0.0013
Further Details:      
 
Domain Number 7 Region: 166-263
Classification Level Classification E-value
Superfamily beta-Roll 0.00000000000000196
Family Serralysin-like metalloprotease, C-terminal domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0JJN8
Sequence length 1059
Comment (tr|B0JJN8|B0JJN8_MICAN) Uncharacterized protein {ECO:0000313|EMBL:BAG02680.1} KW=Complete proteome; Reference proteome OX=449447 OS=Microcystis aeruginosa (strain NIES-843). GN=MAE_28580 OC=Microcystaceae; Microcystis.
Sequence
MTSTLLSILPVVDDVLFNFAQSDGFWANLAIAFGTSYDVVKATELQQQWHSRNFSQIPPI
EVLSDEVLGTANGAYSSSTNKIYLSASFLNTASSAAIINVILEEIGHYVDAQINPVDSAG
DEGAIFSELVQGNSLDVATLDALRAENDQTTIIVNGEIIQVEQADFTGTNGNDNITGTSA
SDNIFGLDGNDTLSGLGGSDNIYGGNGNDSLNGGDGSDYFTNDAGNDTINGGSGTDRYEV
DYSSASSGLTMTYNTTTGSGTITVGTETDTFTSIESFNGFKGTEYNDVIFGGTESEFYYY
YGALSGGSGNDTISGNAGFDEIYGEDGNDVLNGGADNDQLYGGSGNDSLNGDAGDDYFTN
EDGNDTINGGSGIDRYEADYSYASSGLTMTYNTATGSGTITVGTETDTFTSIESFEGFKG
TEYNDVIFGGTENEYYEGGLKGGGGNDTISGNAGFDRIYGEDGNDVLNGGVGNDQLYGGN
GNDLLNGDSGDDYFTGDEGNNDTINGGAGSDSYHADYSYGSSGLTMTYDTAGSGTITVGT
ETDTFTSIESFDGFKGTDYNDVIFGGTAVEQLYGREGNDTISGNAGSDYIYGENGNDVLN
GGDGYDDLYGGNGNDTLQGTDGGTGESDYLVGGSGSDRFILADTTKTFYDDGLTATEGTS
DYAEIAGFSTIDDTIQLRGSSSDYLLTVSGSTTNLYINKPGSEADELIAYISNQTALSLT
ASYFSYVSSPTLPSITLAVSPASVTEDGTTNLVYTFTRTGVTTDALTVNYTVSGTATNGT
DYASIPTSVIFAANSATATVIVDPTADTTVESDETVILTLAAGTGYTIGTTTPVTGTINN
DDSASISINDVTVSEGNSGTTNAVFTVTLSNPVDTSVTLNYATANGTATTADNDYTAIAT
TPLTFNVGETSKTITVAVNGDTKVENNETFFVNLSNLQANGRNVTITDNQGQGTINDDDS
TVTSQLSINDITVVEGQNSNAILTVTVNNPSTQQITVNYTTTAIDATANVDYTSKTGTIT
IAPNTATATISIPILNDNLNEPDEAFTVTLSNGSISPLQ
Download sequence
Identical sequences B0JJN8
WP_012265887.1.4043 449447.MAE_28580 gi|166365599|ref|YP_001657872.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]