SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0JJS4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0JJS4
Domain Number 1 Region: 4-264
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.83e-26
Family Tryptophan biosynthesis enzymes 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0JJS4
Sequence length 283
Comment (tr|B0JJS4|B0JJS4_MICAN) Photosystem I biogenesis protein {ECO:0000313|EMBL:BAG02716.1} KW=Complete proteome; Reference proteome OX=449447 OS=Microcystis aeruginosa (strain NIES-843). GN=MAE_28940 OC=Microcystaceae; Microcystis.
Sequence
MNLIATFKTKNPIIGVVHLAPLPTSPRWGGSLKTVIERAEQEATALAAGGVDGLIIENFF
DAPFTKQQVDPAVVSAMTLIVDRIKNLVVLPIGLNVLRNDAHSALAIATCVNAQFIRVNV
LTGVMATDQGIIEGQAYELLRYRRELGSEVKILADVLVKHARPLGTPNLTTAVQDTIERG
LADGVILSGWSTGSPPSFEDLELAVAAAKGTPVFIGSGADLDNIGRLLPAADGVIVASSL
KRHGKITEPVDPIRVSQFVETARQINDQKAKINNSLPSLPLST
Download sequence
Identical sequences B0JJS4
gi|166365635|ref|YP_001657908.1| 449447.MAE_28940 WP_012265911.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]