SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0JL45 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  B0JL45
Domain Number - Region: 31-201
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000213
Family CBM4/9 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0JL45
Sequence length 246
Comment (tr|B0JL45|B0JL45_MICAN) Uncharacterized protein {ECO:0000313|EMBL:BAG06044.1} KW=Complete proteome; Reference proteome OX=449447 OS=Microcystis aeruginosa (strain NIES-843). GN=MAE_62220 OC=Microcystaceae; Microcystis.
Sequence
MELKSCSQVTTIALGISSSILFTVSFVSPASAVNLIINGSFEEGDYDSNVVDPNFARLSQ
GSSALTGWTIGGAGVDWHNSNDMKFPIEGDLIIDLNLDGGSSGTLSQTFSTIIGQFYTLS
FSLAGPDLSATNPSFPNPRQVSVQVAAVNQIFSTSASDHLDLQWQLHELSFQATGNQTTL
TFSSLDNSGFWGPALDNVTVVSNAESVPEPSSILSILALGTLGAASTLKRQFKSSKSTEK
ETTKVS
Download sequence
Identical sequences A0A1V4BWL5 B0JL45
gi|166368963|ref|YP_001661236.1| WP_012268334.1.4043 WP_012268334.1.79847 449447.MAE_62220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]