SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0JNR7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0JNR7
Domain Number 1 Region: 359-539
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.9e-43
Family Pyruvate oxidase and decarboxylase PP module 0.0000815
Further Details:      
 
Domain Number 2 Region: 1-175
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 6.38e-42
Family Pyruvate oxidase and decarboxylase Pyr module 0.00003
Further Details:      
 
Domain Number 3 Region: 161-334
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.31e-34
Family Pyruvate oxidase and decarboxylase, middle domain 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0JNR7
Sequence length 547
Comment (tr|B0JNR7|B0JNR7_MICAN) Pyruvate decarboxylase isozyme 1 {ECO:0000313|EMBL:BAG03497.1} KW=Complete proteome; Reference proteome OX=449447 OS=Microcystis aeruginosa (strain NIES-843). GN=MAE_36750 OC=Microcystaceae; Microcystis.
Sequence
MITIGEYLCQRLHNLGVNHVFGVPGDYVLDLMDVLVESPIELVCTCNELNAGYAADAYAR
VKGMGAVCVTYGVGGFSLVNAVVGAYAERVPLVVISGASDRSIRRDNLLLHHTTGDYNLQ
LSIMEKVTVASVILTNSAQAASQIDQTLAACLHHKRPVYIEIPRDLVYRPCIPSEKPIYL
TDNLTDAAALEEAIEEAAFLLEKAEKPIILAGVEFHRFKLQDKLLKLLEVTGYPLATTIL
GKSSISEMQPQFIGTYVGALSREYVSQRVENADCVLCLGAIMSDMNLGGFTANLNPNNLI
NANSEKIKIKHHFYQPVFLGDFIEGLINKLSHKEAATLEIKPAVELKNLEFIPVPEQKLT
NARFYERMNHFIAQESFVISDTGDAIIATIDLLMPQKTDFIGQAFYLSIGYSIPACLGVA
FAAPNTRPIVFVGDGAFQMTAQELSTIIRHHLNPIIFLINNDGYTIERVIQDNIYNDLQP
WKYHQLPAVFNGESWSCQVGTEGELEKALSIAQGNIDRLSFIEVHLDRFDCSQGLTRLGQ
ALRSPHA
Download sequence
Identical sequences B0JNR7 I4HQU4
gi|166366416|ref|YP_001658689.1| WP_002796891.1.4043 WP_002796891.1.50331 449447.MAE_36750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]