SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0JP68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0JP68
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 4.71e-29
Family HD domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0JP68
Sequence length 198
Comment (tr|B0JP68|B0JP68_MICAN) Uncharacterized protein {ECO:0000313|EMBL:BAG00379.1} KW=Complete proteome; Reference proteome OX=449447 OS=Microcystis aeruginosa (strain NIES-843). GN=MAE_05570 OC=Microcystaceae; Microcystis.
Sequence
MRQQVIDWLKENVNEHRLRHILGVETMCIDLARHHDLDPVQAGQAGLLHDLAKFFKPKKL
LKMAESAGIDVDNICLSHPHLLHADVSAVVAQKEFNVTDEEILEAIRNHTLGKPNMSDLS
CIVFIADALEPNRGDTPELNALRQLSYQNLHKSVQQTCDYSLKYLLSSHCPIHPRTVLTR
NWALQIVKEQPTETKTID
Download sequence
Identical sequences A0A0K1RXJ7 B0JP68 I4FVI9
449447.MAE_05570 gi|166363298|ref|YP_001655571.1| WP_002763152.1.24258 WP_002763152.1.4043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]