SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0JT21 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0JT21
Domain Number 1 Region: 348-688
Classification Level Classification E-value
Superfamily Subtilisin-like 8.9e-59
Family Subtilases 0.000043
Further Details:      
 
Domain Number 2 Region: 1374-1475
Classification Level Classification E-value
Superfamily CalX-like 1.11e-24
Family CalX-beta domain 0.00094
Further Details:      
 
Domain Number 3 Region: 1327-1349,1391-1421,1511-1607
Classification Level Classification E-value
Superfamily beta-Roll 2.09e-21
Family Serralysin-like metalloprotease, C-terminal domain 0.0009
Further Details:      
 
Domain Number 4 Region: 1254-1364
Classification Level Classification E-value
Superfamily CalX-like 1.07e-19
Family CalX-beta domain 0.0031
Further Details:      
 
Domain Number 5 Region: 976-1090
Classification Level Classification E-value
Superfamily CalX-like 7.72e-19
Family CalX-beta domain 0.0023
Further Details:      
 
Domain Number 6 Region: 1094-1155,1203-1247
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000000623
Family Proprotein convertase P-domain 0.045
Further Details:      
 
Domain Number 7 Region: 811-874,922-965
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000261
Family Proprotein convertase P-domain 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0JT21
Sequence length 1692
Comment (tr|B0JT21|B0JT21_MICAN) Uncharacterized protein {ECO:0000313|EMBL:BAG01065.1} KW=Complete proteome; Reference proteome OX=449447 OS=Microcystis aeruginosa (strain NIES-843). GN=MAE_12430 OC=Microcystaceae; Microcystis.
Sequence
MKTTQVSSDLSSTNMPSLEDSLRFEQSLSITGDLTGSDDLTVSKETSPLGVLNSNPSPST
VSSEAATVPVSPAATSQVAFPASPSIDSSGYSTSQASGPASVPAAAPVTSSPALGLASVP
TAEGGDSRVNQDNLNQKTGENRQANSPIPVVDRGDFYWADGQPVKLLQRTTQITLTLTDR
ATRLNDLLAAGQILEGLKLEKNVSQNTYILSSKTATALDIAQIEARLGEIPGVRVAPVYQ
SPLTNTWLVATNEIIVSLRPGLKAQEVFGNDSRFASYRSLLGTPNQFVVTLQEGLPNLAT
ANALQSDRSFQWASPNFYQQRERFFIPNDPLFGNQWHLNNTGQVGGTPDADVDAPEAWDV
NAGGSSNVVVAVIDDGMQLNHPDLQLFINTGEIAGNGIDDDGNGWIDDVNGWDFTSGGIG
DNNPGPSVPDDAHATAVAGVAAGRGNNTLGVTGMAYNSRLLPVRIFLGGSATSDANIASA
IYYAAGRTASGTGTWRAGDILNNSWGGGGFSSAISSAFTWASTSGRDGKGAISYIATGNG
FGAPVSFPANLSSTIPGVIAVGASTNLDQLASYSNVGPQVDFVAPSGGPTYGGTANIVTT
DRTGADGYNSTSDYTTTGADGFSGTSSATPLAAGIGALILAQDPSLTAAQVRGLMRNTTD
LIGPVAYDNKGFNTQYGYGRVNANTAIRGVGIAEIQVLQDRTNIADNTGSFSFAAGVGQT
QTQTFRVRNQGTKDLTLGAISLGGGSGFSLASSFTDTTLSVGESTTFSVNFSPTTTGTFS
NTISFTNNDADESTFNFTLNGTGLNSKSFSNTSPITIPDSGTSTPYPSTINVSGLTGNIN
SLKVTLTNLSHTWPDDIDVLLVGPTGTKALLMSDVGGSSDVSNVTLTFDPTATSFLPDEG
LITSGSYKATDVGTGDIFNAPAPGGPYGTDFSVFNGINPNGTWSLYVVDDEGPDAGTIAG
GWSLDIGTGGGSTKTISIAKTTDGKEAGSVSSVFTLTRTGDLSSALTVTYTLAGTATLGS
DYNDPSLGQAAFVAGSPTATITLPTIDDSVVDPSETIITKITAPTGYTISGSDTATATIV
DNDGGGGNIFSNPNPITIPDSGSSTPYPSTINVSGLSGNINSLKVTLTNLSHTYPDDIDV
LLVGPTGTKALLMSDVGGFNSLSNVTLTFDPTATSFLLDEGLITSGSYKATDFLTGDIFN
APAPGGPYGTDFSVFNGINPNGTWSLYVVDDAGGDVGTIAGGWSLDIGTATTLPVVTVAA
TDADAGEPTNNGQYTLTRTGDTTSALTVNIAMSGTATNGTDYTTISTPVNFAAGSATALV
DLNVIDDTLVEGTETAILTVLAGTGYTVGSAASATVNIADNDLPDLPIIDLSANQTVVEG
ITSPQNVTYTVTLSSDSTDTITVQYATGDNTAIAGSDYTTTKGTLTFAPGVTSQDIIIPI
LNDSLNEAQETFNLTLSSPTNAQLGTAAVTTTITDTLVTAASTTLAANVENLTLTGTAAI
NGTGNNGNNVIIGNSANNTLTGLAGNDTLNGGAGNDNLISGDGNDLLLGGAGNDTLNGGL
GVDTLTGGVGNDFFRLDNVANGDLITGFSVADDTIILANSLDSTLTGPINPGIKGLLFIS
GNVNGSVLSAAGFFKGAGINGGASGNSSGIYVNTSNGDIWYNDSTVAGSYLIANVGAGAA
AGMTNLDFVYGV
Download sequence
Identical sequences B0JT21
gi|166363984|ref|YP_001656257.1| WP_012264684.1.4043 449447.MAE_12430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]