SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0JT30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0JT30
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily beta-Roll 3.77e-34
Family Serralysin-like metalloprotease, C-terminal domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0JT30
Sequence length 182
Comment (tr|B0JT30|B0JT30_MICAN) Calcium-binding protein {ECO:0000313|EMBL:BAG01074.1} KW=Complete proteome; Reference proteome OX=449447 OS=Microcystis aeruginosa (strain NIES-843). GN=MAE_12520 OC=Microcystaceae; Microcystis.
Sequence
MYGNEGNDSIYGQGGNDYIDGGIGNDYIDGGDGADIIFGRAGNDNVFGGNGSDLLIGEAG
ADTLSGGNDTDYLFGGADNDVLLGGAGNDFVYGGYGNDILTGGTGADAFFFGSLLEGVDV
IKDFQWIEGDVIQLSKSGFNASSLSQFNYNSLTGGLSFLGQQFATIENRPAGFAVSLDVQ
LI
Download sequence
Identical sequences B0JT30
gi|166363993|ref|YP_001656266.1| 449447.MAE_12520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]