SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0JTV1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0JTV1
Domain Number 1 Region: 541-670
Classification Level Classification E-value
Superfamily beta-Roll 0.0000000000000131
Family Serralysin-like metalloprotease, C-terminal domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0JTV1
Sequence length 702
Comment (tr|B0JTV1|B0JTV1_MICAN) Uncharacterized protein {ECO:0000313|EMBL:BAG01139.1} KW=Complete proteome; Reference proteome OX=449447 OS=Microcystis aeruginosa (strain NIES-843). GN=MAE_13170 OC=Microcystaceae; Microcystis.
Sequence
MTVDQNSIVGLYVIYFNRSPDPQGLTFWQSQDVTIEEMAAQFGASPEAKSLYPFLASPTL
GDPVAFINEIYQNAFGRDADDAGLEYWSGVLEQDSSPEAVAEFVLAVAQGAQGTDRVALQ
NRADIALQFTQEALNAGIPFTASLFATSSQIIDTVTFTDESVADAEDAIEQAIIDIIGGG
TGTTFTLLEQGAVLTAAASTHVSPADKFLSTANDQINGTVFLDGSVIQDPSTSDNDVLTA
TILPDVFDFQTIPFISKIEDIKLTGSPGGVVDIANITDVKTLEFVTGNITVLTSEKHPLN
LAEGYAGTLTVLQTNKNSQTTINLNGTVAGTRIVDGLVDNLIIKDTRFQNNASQINIVVK
ADSVLKASDTTTNPTIRDTQTGENTNFVISGDKNLTIDGAVQMARGNSTAQLDATALTGK
LTLNLANILSTEVDPFSVKQIVGGKSDDSFTLTAITNQLVGVAINGSDGEDTITASLGDE
TSILALNRVTNVETVIVKQTSFVNTVLNPNDSFVASGKSATVDASSFTVSKLTYDGSLET
NGTLNIIGGALKDTLEGGAKNDTLTGGASADTLTGGPGTGNDTFVYKSIADSNFDSTIAF
DTITDFQVAGDVLNLKAVGFTSTQFLGTFEAKQDTLLDAAKAVSFNIGKNALAAFTYTGA
EDLFKDNTFVLGTNNSAIDVVDAGDLFIQLTDDLTLTSVNFA
Download sequence
Identical sequences B0JTV1
WP_012264749.1.4043 gi|166364058|ref|YP_001656331.1| 449447.MAE_13170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]