SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0JYS9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0JYS9
Domain Number 1 Region: 24-297
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.36e-85
Family Eukaryotic proteases 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0JYS9
Sequence length 334
Comment (tr|B0JYS9|B0JYS9_XENTR) Uncharacterized protein {ECO:0000313|EMBL:AAI58898.1, ECO:0000313|Ensembl:ENSXETP00000013798} KW=Complete proteome; Reference proteome OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=LOC548809 OC=Silurana.
Sequence
MRWRSIVPVSLTAAHTVAETMEFAGIILLLLVSASPTVSQNTTASPRICGSPLVSSRIVG
GTDATNGAWPWQISLRYKGSHICGGSVISNQWIMTAAHCFEYSRTPSDYQVLLGAYQLSV
ASASELLSSVARVIVNPSFTIPGGPGDIALLKLTSPVAYTEYILPVCVPSSASGFYEGMQ
CWVTGWGNIGSAVTLPYPQTLQQVMTPLISWSTCNQMYHVQSGISSNIAIVPKDQICAGY
AAGQKDSCQGDSGGPLVCQLQGVWYQIGIVSWGDGCAQASRPGVYTLVPNFKSWLSSYNA
TTDNPDTSSYAQKSHSPAIHIHTLLIATCLLLYS
Download sequence
Identical sequences B0JYS9
8364.ENSXETP00000013798 ENSXETP00000013798 gi|166796549|gb|AAI58898| gi|167908783|ref|NP_001016055| gi|213627780|gb|AAI71053| NP_001016055.2.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]