SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0JZV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0JZV6
Domain Number 1 Region: 115-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000524
Family EGF-type module 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0JZV6
Sequence length 226
Comment (tr|B0JZV6|B0JZV6_XENTR) LOC100145251 protein {ECO:0000313|EMBL:AAI59335.1} OX=8364 OS=Xenopus tropicalis (Western clawed frog) (Silurana tropicalis). GN=LOC100145251 OC=Silurana.
Sequence
MFSLRSVILCATLLLTIACNFTVHCSELNSTQADSNVTFSGDHGSDGTGSAVEVNWEEEE
GEEHEDDFSILGFITDDSIRAEPVIKPENPPKKGEKKNSEKKKKKERGDKKKKKKKNPCQ
TTHKDYCIHGECKYLTSLQEVTCICQPEYFGERCSEQSMKSQTKGNLSDTSTIALAVVAV
LLSTISITAIIIIIVVHTRRKYASYQCEVEEKKRLGQENGSEEIDV
Download sequence
Identical sequences B0JZV6
gi|166796458|gb|AAI59335| gi|187607327|ref|NP_001120205| NP_001120205.1.99540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]