SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0K7T6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0K7T6
Domain Number 1 Region: 45-476
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.69e-76
Family Amylase, catalytic domain 0.000000524
Further Details:      
 
Domain Number 2 Region: 657-751
Classification Level Classification E-value
Superfamily Starch-binding domain-like 8.34e-29
Family Starch-binding domain 0.0001
Further Details:      
 
Domain Number 3 Region: 480-569
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 6.82e-22
Family alpha-Amylases, C-terminal beta-sheet domain 0.00055
Further Details:      
 
Domain Number 4 Region: 577-651
Classification Level Classification E-value
Superfamily E set domains 0.0000000000308
Family E-set domains of sugar-utilizing enzymes 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0K7T6
Sequence length 757
Comment (tr|B0K7T6|B0K7T6_THEP3) Alpha amylase, catalytic region {ECO:0000313|EMBL:ABY94335.1} KW=Complete proteome; Reference proteome OX=340099 OS=(Clostridium thermohydrosulfuricum). GN=Teth39_0672 OC=Thermoanaerobacteraceae; Thermoanaerobacter.
Sequence
MAALIKKKRLSVLVAVIILLAFSFNLQPVTVEATSTGGLGPVTPKDTIYQIITDRFYDGD
PSNNIPPGFDPTLFDGTGSDLKLYQGGDWKGIIEKIPYLKEMGITAVWISAPYANRDTVI
EDYHPDGSVDRWTSFHGYHARNYFATNKHFGEMQDFIALRDALHSNGIKLVIDFVSNHSS
RWQNPTLNYQPEDGRLYEPDKDENGNYVFDSNGNPVDYNGDGIVENLLADPHNDIHGFFH
GLGDRGDDNTRFGYRHKDLGSLADYSQENSVVVEYLEKAAIFWKSKGIDGIRHDATLHMN
PAFVQGFKDAIDSAPGGPITHFGEFFIGRPDPKYEEYRTFPDRTGVNNLDFEYYRAATNT
FGYFSETMKDFGEMMIKTSNDYIYENQAVTFIDNHDVTRFRYIQPNDKPYHAALAVLMTS
RGTPNIYYGTEQYLYPADASDIAGRMFMQTSTSFDQTTTAYKLIRKLSDLRRSNEAVAYG
TTEILYSTDDVLVFKRQFYDKQVIVAVNRQPDRSFAVPDLKTTLPVGTYQDVLEGLLYGK
SMTVVEENGQHKIKGFTLSGGEVNVWAYNPSLGTEIPRIGNVISTMGRPGNLVYIYGTGL
GGNVTVKFDTTPAQVVSNSDEMITAVVPNTPGIKSITVIKGNYTSNSFRYHVLSGDLVQV
IVKVNASTEWGQNIHIVGNLPELGGWDPAMSTEAMMCPNYPEWFLPVSVPMGTTFEFKFI
KKDSNGNVIWESGENRIFTSPNTSTGTVDTPVYNWRY
Download sequence
Identical sequences B0K7T6 E8UWK2
gi|320115508|ref|YP_004185667.1| gi|167037093|ref|YP_001664671.1| WP_012269126.1.2934 WP_012269126.1.56562 340099.Teth39_0672

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]