SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0KWD5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0KWD5
Domain Number 1 Region: 332-424
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.28e-24
Family Tudor domain 0.00000326
Further Details:      
 
Domain Number 2 Region: 50-121
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.05e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 3 Region: 122-203
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000757
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0KWD5
Sequence length 560
Comment (tr|B0KWD5|B0KWD5_CALJA) Tudor and KH domain-containing protein isoform a {ECO:0000313|EMBL:JAB08029.1} KW=Complete proteome; Reference proteome OX=9483 OS=Callithrix jacchus (White-tufted-ear marmoset). GN=TDRKH OC=Platyrrhini; Cebidae; Callitrichinae; Callithrix; Callithrix.
Sequence
MSTERTSWTSLSTIQKIALGLGIPASATIAYILYRRYRESREERLTFVGEDDIEIEMRVP
QDAVKLIIGRQGANIKQLRKQTGARIDVDTEDVGDERVLLISGFPVQVCKAKAAIHQILT
ENTPVSEQLSVPQRSVGRIIGRGGETIRSICKASGAKITCDKESEGTLLLSRLIKISGTQ
KEVAAAKHLILEKVSEDEELRKRIAHSAETRVPRKQPISVKREEVTEPGGAGEPALRKNS
SSSMEPAAPLVTPSPKGGGDMAVVVPKEGSWEKHSDDSFQKSGAQAISEMSMFEIPSPDF
SFHADEYLEVYVSASEHPNHFWIQIVGSRSLQLDKLVNEMTQHYENSVPEDLTVYVGDIV
AAPLPTNGSWYRARVLGTLENGNLDLYFVDFGDNGDCPLKDLRALRSDFLSLPFQAIECS
LARIAPSGDQWEEEALDEFDRLTHCADWKPLVAKISSYVQTGISTWPKIYLYDTSNGKKV
DIGLELVRKGYAIELPEDVEENRAAPDMKDMATETDASLSTLLTETKKSSGEITHTLSCL
SLSEAASMSGDDNLEDDYLL
Download sequence
Identical sequences B0KWD5
XP_008982622.1.60252 ENSCJAP00000014807 ENSCJAP00000014811 ENSCJAP00000014787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]