SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0PDL8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0PDL8
Domain Number 1 Region: 702-858
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 9.81e-31
Family SMI1/KNR4-like 0.0096
Further Details:      
 
Domain Number 2 Region: 30-142
Classification Level Classification E-value
Superfamily TPR-like 0.000000043
Family Tetratricopeptide repeat (TPR) 0.038
Further Details:      
 
Weak hits

Sequence:  B0PDL8
Domain Number - Region: 537-673
Classification Level Classification E-value
Superfamily TPR-like 0.00159
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0PDL8
Sequence length 1561
Comment (tr|B0PDL8|B0PDL8_9FIRM) Tetratricopeptide repeat protein {ECO:0000313|EMBL:EDS10570.1} KW=Complete proteome; Reference proteome OX=445972 OS=Anaerotruncus colihominis DSM 17241. GN=ANACOL_03172 OC=Anaerotruncus.
Sequence
MGQRLVFQPGDGLELEIKEENKMELLEQCQIWNENDEYQKIIDALEAVPAGERTPEMDSE
LARAYNNLAELGDRELFKKAIALLAPHEEYFEGDHCWNFRMGYSYYYLDQEGRALPYFRK
ALEARPGDEDSQMLINDCEKRITLPRFEKCFRERTEAAWEAFAQQEAGLRRFMDEDKNRE
RGEELIGQCEKILNFAFDEICFEMGFNGKKHELILTPEGNRVKLFQLVYFQKHAPKEVLE
HWNILVGRQSNPNIGLRSGGWEISGDDVQLWLEQQGENSFALSAYCEKLLPLLREDENRV
WWILTNLTDQVLGEIPHMRYIDSFDMLETPREEPCVLLSKLPDELKGMGLDLSIDPEVLL
ESYTGYEMKPDENPDADWRLDIIAGITCCPPFINDYMSAESGCMDDFHADGAVAGFFCYP
LDTLRDENGSQKIFDFREKLESALLADAGEDAVTLTGGATGLYCGYVDFIAWDLRAVLNA
AQEFFDETDLPWASFHVFRRDVGTVTLKEPEGDKPEDDGFDDEESLDNLEYIPYTPENAE
AFYRQLERWNDEDEYTRCIAALGTIHKDQWDYRAAYAMARALENYAIIGDHEEGTPNYKG
DKALLQAIEMLESVREEGQDKAEWNMRMAYGYQYLHGQEEKAIPYAQRWAELDPEDEDAP
AVIRECRQEIRNRQRSRKKKTRFAPGDTPFEGFDFTDFWDDDEYALKEYVSEPPSDELIA
SVEEELGYKLPASYICLMKQHNGGIPANTCYPSDEPTSWADDHIAITGIFGIGREKDYSL
CGKLGSRFMIDEWEYPAIGIAICDCPSAGHDMIFLDYRDCGPQGEPAVVHVDQENDYKIT
RLADSFEEFICGLENESVYDMDEDDDNEDDDTDEEADQDSRGAFAGFVLMSKGSWDKAQF
IQDMKAKWDITVEEDEDGGNRDDAVVFEVGGMIAAVSLMPYPIPDGEAELNAENNYMWPE
AVKAAKEHCAHIMVAVLGKEENLLERGKFYAKLVAACCRQKYAAGVYTSGVVFEPRFYEG
FADMMQEDELPIFNWIWFGLYRNEGGMSAYTYGMEVFGKDEMEVLNTGAEPGELRDFLAS
LVSYVLENDVELHDGETIGFSAEDKHTITRSKGVALPDQMTLKISYVPAGDDPEQDDDDS
IGMDDASWHMESIEEKELEIDPINACSHMAIYLRWCIEHDLMEENFLSEHSEVVKQVKAD
PANVDLRAFIREKLFGCLYSALFNQQGRAFAGYYYGEGDSPYFPSDVDDYALQYFGPKRY
HSNEFQQEAYLFIPFDEDYYQAMAKVIDKRFVNWQGQGFDEDTLEPSDVAQAIMEYLDCE
CTYFPSMKDDDPIMSAYSYARRLGVREGFIPVLVKPDETLLECLVMNADPENEADCYEFD
LKTVTGYRKKILDAPIKDGKAVLEQLAGQRREEAEDDDLDWAEEVLGEMEGGYDNCRFSC
YWDSDTNMTYPLILAKIPVKNPWDIFAYLPFGNWNECPDTPELMAAAKYWFEQYGAVPAA
MTHDELEFELPAPISKEKAMEAATEQYGFCPDIVDQEQDDPTVGNLADVLWQSTVWYFWW
D
Download sequence
Identical sequences B0PDL8
WP_006876036.1.92265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]