SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0QYJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0QYJ1
Domain Number 1 Region: 19-180
Classification Level Classification E-value
Superfamily Rhomboid-like 0.000000000000863
Family Rhomboid-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B0QYJ1
Sequence length 195
Comment (tr|B0QYJ1|B0QYJ1_HUMAN) Rhomboid domain-containing protein 3 {ECO:0000313|Ensembl:ENSP00000413128} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RHBDD3 OC=Catarrhini; Hominidae; Homo.
Sequence
MHARGPHGQLSPALPLASSVLMLLMSTLWLVGAGPGLVLAPELLLDPWQVHRLLTHALGH
TALPGLLLSLLLLPTVGWQQECHLGTLRFLHASALLALASGLLAVLLAGLGLSSAAGSCG
YMPVHLAMLAGEGHRPRRPRGALPPWLSPWLLLALTPLLSSEPPFLQLLCGLLAGLAYAA
GAFRWLEPSERRLQV
Download sequence
Identical sequences B0QYJ1
ENSP00000413128 ENSP00000413128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]