SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0QYT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0QYT4
Domain Number 1 Region: 7-132
Classification Level Classification E-value
Superfamily RNI-like 0.000000000628
Family Rna1p (RanGAP1), N-terminal domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0QYT4
Sequence length 133
Comment (tr|B0QYT4|B0QYT4_HUMAN) Ran GTPase-activating protein 1 {ECO:0000313|Ensembl:ENSP00000394787} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=RANGAP1 OC=Catarrhini; Hominidae; Homo.
Sequence
MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNT
VGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLS
DNAFGPDGVQGFE
Download sequence
Identical sequences A0A2J8LN63 A0A2J8TWT0 B0QYT4
ENSP00000394787 ENSP00000394787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]