SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0R7P3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0R7P3
Domain Number 1 Region: 63-225,353-492
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.04e-47
Family Tandem AAA-ATPase domain 0.0000435
Further Details:      
 
Domain Number 2 Region: 568-700
Classification Level Classification E-value
Superfamily Restriction endonuclease-like 2.28e-27
Family XPF/Rad1/Mus81 nuclease 0.000053
Further Details:      
 
Domain Number 3 Region: 711-778
Classification Level Classification E-value
Superfamily RuvA domain 2-like 0.0000000000000826
Family Hef domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0R7P3
Sequence length 784
Comment (tr|B0R7P3|B0R7P3_HALS3) ATP-dependent RNA helicase/nuclease Hef {ECO:0000313|EMBL:CAP14762.1} KW=Complete proteome OX=478009 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1). GN=OE_4310F OC=Halobacteriaceae; Halobacterium.
Sequence
MSEEMGYVDHPMLADGVIEARQYQLQLAAAARQGHTLVCLPTGLGKTTVSLLVTAYRLAD
DAGGTALLLAPTKPLVEQHAGFYREALAIPDDDVVVFTGETRPDDRRAAWTDARVVVATP
QVVENDLVGGRIDMDDVVHCTFDECHRATGDYAYTYVAERYHADAAAPLVTAMSASPGGT
EAEIRTVCENLGVGNVEVMTEDDADVGEHTHDTDVQWERVTLPEEILEVRDAINDVIEDR
LAKLREIGVTKASSPDISQKDLNEIRARLQQLIDDDDSDGYQGMSVHAEVMKLKRAVELV
ETQSVESVRRYFERQRNAANTAGASKASQRLVSEPAVKRAMRTAREFDGLHPKFRQARML
LAETLGIEDGDRVIVFTESRDTAEALTAFLGEHFDTRRFVGQGDADGSDGMTQTEQRETL
AEFRNGDFEVLVSTSVAEEGLDVPEVDLVLFFEPVPTAIRSVQRKGRTGRQTAGRVVVLL
AEDTRDEAYFWISRRREQEMTEELQSLKGRADELETELGGDGAQQALDEFGDAEAAGEEP
AAPAPEDVSDGEDTEGVAARVDGAGEAVEVVVDQRELDSTIARELSKRDGVETRLETLAV
GDYVVSDRVAVERKSHSDFMDTLLGSERSIFEQAKELARQYTRPVLVVEGDGDLYAERNV
HPNAVRSAMASLAVDWGLSVMHTNGEGDTTEMIETIAEREQTTNDRAVSAHGEKAAKTQG
EQQEYVVSSITDVGPVTARSLLDTFGSVEAVMTASEDELTAADGVGAVTAERIRGVVGTE
YQPE
Download sequence
Identical sequences B0R7P3 Q9HMW5
gi|169236908|ref|YP_001690108.1| gi|15791152|ref|NP_280976.1| 478009.OE4310F 64091.VNG2356G WP_010903758.1.1784 WP_010903758.1.50382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]