SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0RPY6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0RPY6
Domain Number 1 Region: 206-281,312-366
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000262
Family SMI1/KNR4-like 0.015
Further Details:      
 
Domain Number 2 Region: 27-74,104-176
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000249
Family SMI1/KNR4-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0RPY6
Sequence length 373
Comment (tr|B0RPY6|B0RPY6_XANCB) Uncharacterized protein {ECO:0000313|EMBL:CAP50521.1} KW=Complete proteome OX=509169 OS=Xanthomonas campestris pv. campestris (strain B100). GN=XCCB100_1173 OC=Xanthomonadaceae; Xanthomonas.
Sequence
MAGLEWKVYGRAPTLDTFWDEALNLERSPATDASIAAAQARLGVRLPDWLRHLYARYDGG
AVQMARGQSLQQPDNWLAAEWLIPRARLLGAEALFSFAQVRAREDYRDDAYAGLAASGDD
RWLIAIAADARAPSRALCLDYAAPDTEPTLVYVDAGSGQRLIVFEGVEDLLAQLVDVVYW
SPALQAKYDDNERVQWQPQPPALETFWSGPGHWSDALTVADTKALAAAEARLGVRLPALF
KRLYGVQDGGDTGWCWVPRTRFPSYRYVDWECVLVDRYLSPLAQIGSVLDFAAAFEDPQD
FSSAAYLHAGLDQVLVLSSHNVDCLLCLDYRGRGPHYAPEVVYFERWEGLHPTWRAPSFE
AFFSTLRQADLDF
Download sequence
Identical sequences B0RPY6
WP_012437667.1.10627 WP_012437667.1.22538 WP_012437667.1.4502 WP_012437667.1.82601 509169.xccb100_1173 gi|188990569|ref|YP_001902579.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]