SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0S6R8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0S6R8
Domain Number 1 Region: 373-557
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.31e-54
Family SPRY domain 0.001
Further Details:      
 
Domain Number 2 Region: 8-81
Classification Level Classification E-value
Superfamily RING/U-box 3.31e-21
Family RING finger domain, C3HC4 0.0077
Further Details:      
 
Domain Number 3 Region: 142-206
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 4.12e-16
Family B-box zinc-binding domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0S6R8
Sequence length 558
Comment (tr|B0S6R8|B0S6R8_DANRE) FinTRIM family, member 24 {ECO:0000313|Ensembl:ENSDARP00000056305} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=ftr24 OC=Cyprinidae; Danio.
Sequence
MAEANISVAEDQFNCSICLDLLREPVTIPCGHSYCMNCITDYWNQNDQRRVYSCPQCRET
FTPRPALNKNVMFAEIVQKLRGASFQTAPALSYAGPGDVECDVCTERKYKAVKSCLACLQ
SYCQTHFERHEEFHSGRHKVTKATGQLKQMICPKHDKLLEVYCRTDQKCICLLCTVDEHK
NHDTVSTTSERTDIQKQLEETQAHFQQKIQEREKRMQELKDAVKTNRHLAQAAEKDSEEI
FAELIRFIERSRSEVIWRIRNQEKDAKSEVEGLLKELEQEIEDLKWRNTELEQLLHTDDH
IHFLQRFQSLCEPSKMTDISRANVSSVLLNEDVGRSVSQLKEKLEQFCKEEIENIFYKEA
KINRAYQTEPKTRKDFLQYFLQLSLDRNTAHQSLCLSEGNTVATYTHTAQHLPDHPDRFT
NFFGVLCRESVSGRCYWEVESIGNERLYGVGVAVSYKSINRKGTRTTSGFGYNDQSWKMI
CSRSRYIFWHNNIKTKLPALFRSSRIGVYVDHRAGVLSFFSVSDTTMNLIHRVQTTFTQP
LYPGFWIDPGSRLKICRL
Download sequence
Identical sequences B0S6R8
7955.ENSDARP00000056305 ENSDARP00000056305 XP_017207758.1.45394 XP_021326976.1.45394 ENSDARP00000056305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]