SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0UXM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0UXM1
Domain Number 1 Region: 91-163
Classification Level Classification E-value
Superfamily F-box domain 0.00000000000000536
Family F-box domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0UXM1
Sequence length 198
Comment (tr|B0UXM1|B0UXM1_DANRE) F-box protein 36b {ECO:0000313|Ensembl:ENSDARP00000116692} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=fbxo36 OC=Cyprinidae; Danio.
Sequence
MASLLGETLFEISGQGPAPMKDYFHFAITKSEVIWSWWKISLRLGCKNAPPGQLRETHED
FLEDNRLQNQVAMVFGSHILQYSKNLCQGYYDFIARLPNALLFKIMGYLDLENISVLSRT
CRKFRELCNSEEFWEQTVRKHCDTVTPTVEALAKEVGWKTIFFTNKLQLQLQISRRKQKD
NQPCEDKDEPSSSSVALE
Download sequence
Identical sequences B0UXM1
ENSDARP00000116692 ENSDARP00000116692 7955.ENSDARP00000057193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]