SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0V3D2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0V3D2
Domain Number 1 Region: 18-74
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000017
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 
Weak hits

Sequence:  B0V3D2
Domain Number - Region: 82-119
Classification Level Classification E-value
Superfamily Orange domain-like 0.0196
Family Hairy Orange domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) B0V3D2
Sequence length 152
Comment (tr|B0V3D2|B0V3D2_DANRE) Hairy-related 4, tandem duplicate 3 {ECO:0000313|Ensembl:ENSDARP00000094984} KW=Complete proteome; Reference proteome OX=7955 OS=Danio rerio (Zebrafish) (Brachydanio rerio). GN=her4.3 OC=Cyprinidae; Danio.
Sequence
MTPTITGSISSRETLLTNKLRKPMVEKIRRERINSSIEKLKTLLAQEFIKQQPDSRQEKA
DILEMTLDFLRRSQKSSAAGDGRSRCVQEAVSFLSQCPVQTQSHTRLMKLFLHMQTPADQ
HTRVDNPQTTETHANSSAKQHTPVRSHIWRPW
Download sequence
Identical sequences B0V3D2
ENSDARP00000094984 NP_001154880.1.45394 ENSDARP00000094984 7955.ENSDARP00000094984

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]