SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B0XA73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B0XA73
Domain Number 1 Region: 37-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000038
Family LDL receptor-like module 0.00049
Further Details:      
 
Domain Number 2 Region: 73-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000367
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B0XA73
Sequence length 169
Comment (tr|B0XA73|B0XA73_CULQU) Uncharacterized protein {ECO:0000313|EMBL:EDS43538.1, ECO:0000313|VectorBase:CPIJ016346-PA} KW=Complete proteome; Reference proteome OX=7176 OS=Culex quinquefasciatus (Southern house mosquito) (Culex pungens). GN=CpipJ_CPIJ016346 OC=Culicidae; Culicinae; Culicini; Culex; Culex.
Sequence
MAGGELFRLMAPMLRTRNHVQTFLSKARVRYGVAAETACSDDKFRCKSGRCIPKHWQCDG
ENDCSDGSDEDSEKCHNKSCPSNEVMCKTGDRCIPRAWLCDRDPDCPDGSDEKECITCDN
REKTNFTLQFREFPSSSSCKVSPGSSPSWDPVNRKHKIPSPNLAHKFIL
Download sequence
Identical sequences B0XA73
XP_001866545.1.94360 7176.CPIJ016346-PA CPIJ016346|conserved

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]