SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1AHC4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1AHC4
Domain Number 1 Region: 398-591
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.08e-51
Family BCR-homology GTPase activation domain (BH-domain) 0.00000142
Further Details:      
 
Domain Number 2 Region: 268-364
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000000000824
Family CRAL/TRIO domain 0.0051
Further Details:      
 
Weak hits

Sequence:  B1AHC4
Domain Number - Region: 39-168
Classification Level Classification E-value
Superfamily Cullin repeat-like 0.000126
Family Cullin repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) B1AHC4
Sequence length 643
Comment (tr|B1AHC4|B1AHC4_HUMAN) PRR5-ARHGAP8 readthrough {ECO:0000313|Ensembl:ENSP00000262731} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=PRR5-ARHGAP8 OC=Catarrhini; Hominidae; Homo.
Sequence
MRTLRRLKFMSSPSLSDLGKREPAAAADERGTQQRRACANATWNSIHNGVIAVFQRKGLP
DQELFSLNEGVRQLLKTELGSFFTEYLQNQLLTKGMVILRDKIRFYEGQKLLDSLAETWD
FFFSDVLPMLQAIFYPVQGKEPSVRQLALLHFRNAITLSVKLEDALARAHARVPPAIVQM
LLVLQGVHESRGVTEDYLRLETLVQKVVSPYLGTYGLHSSEGPFTHSCILELQRDKAAAA
AVLGAVRKRPSVVPMAGQDPALSTSHPFYDVARHGILQVAGDDRFGRRVVTFSCCRMPPS
HELDHQRLLEYKKNLKALYVVHPTSFIKVLWNILKPLISHKFGKKVIYFNYLSELHEHLK
YDQLVIPPEVLRYDEKLQSLHEGRTPPPTKTPPPRPPLPTQQFGVSLQYLKDKNQGELIP
PVLRFTVTYLREKGLRTEGLFRRSASVQTVREIQRLYNQGKPVNFDDYGDIHIPAVILKT
FLRELPQPLLTFQAYEQILGITCVESSLRVTGCRQILRSLPEHNYVVLRYLMGFLHAVSR
ESIFNKMNSSNLACVFGLNLIWPSQGVSSLSALVPLNMFTELLIEYYEKIFSTPEAPGEH
GLAPWEQGSRAAPLQEAVPRTQATGLTKPTLPPSPLMAARRRL
Download sequence
Identical sequences B1AHC4
ENSP00000262731 ENSP00000337287 ENSP00000354732 ENSP00000262731 ENSP00000429240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]