SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for B1ANN8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  B1ANN8
Domain Number 1 Region: 68-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000196
Family HLH, helix-loop-helix DNA-binding domain 0.0000963
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) B1ANN8
Sequence length 218
Comment (tr|B1ANN8|B1ANN8_HUMAN) cDNA FLJ61042, highly similar to MAX-interacting protein 1 {ECO:0000313|EMBL:BAG64876.1} KW=Complete proteome; Reference proteome OX=9606 OS=Homo sapiens (Human). GN=MXI1 OC=Catarrhini; Hominidae; Homo.
Sequence
MERVKMINVQRLLEAAEFLERRERECEHGYASSFPSMPSPRLQHSKPPRRLSRAQKHSSG
SSNTSTANRRAHLRLCLERLKVLIPLGPDCTRHTTLGLLNKAKAHIKKLEEAERKSQHQL
ENLEREQRFLKWRLEQLQGPQEMERIRMDSIGSTISSDRSDSEREEIEVDVESTEFSHGE
VDNISTTSISDIDDHSSLPSIGSDEGYSSASVKLSFTS
Download sequence
Identical sequences B1ANN8
ENSP00000376842 ENSP00000376842

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]